Sequence details NCBI ID: XP_004844999.1 (Protein)

Details from NCBI annotation

Gene Symbol Ndufa12
Protein Name PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 [Heterocephalus glaber]

Database interlinks

Part of XM_004844942.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004844942.1 (Coding sequence)

Sequence Protein

Length: 145 aa     
View alignmentsRaw sequence   
>XP_004844999.1
MELVQVLKRGLQQVTGHGGLRGLLRVFFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTHPPTDRKFIWRNHKFNVSGSPEQYVPYSTTRKKIQEWVPPSTPHK