Sequence details NCBI ID: XP_004844709.1 (Protein)

Details from NCBI annotation

Gene Symbol Pole4
Protein Name PREDICTED: DNA polymerase epsilon subunit 4 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004844652.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004844652.1 (Coding sequence)

Sequence Protein

Length: 117 aa     
Raw sequence   
>XP_004844709.1
MAAAAPAGSGTPREEEGPGGEAGAAQPQAPTSGPGARLSRLPLARVKALVKADPDVTLAGQEAIFVLARAAELFVETIARDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD