Sequence details NCBI ID: XP_004844626.1 (Protein)

Details from NCBI annotation

Gene Symbol Cd8a
Protein Name PREDICTED: T-cell surface glycoprotein CD8 alpha chain [Heterocephalus glaber]

Database interlinks

Part of XM_004844569.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004844569.1 (Coding sequence)

Sequence Protein

Length: 237 aa     
View alignmentsRaw sequence   
>XP_004844626.1
MAPRVTSWLLLQVALLLDAAEAQGPNQFRMSPPKLVAGVGETVTLRCEVLMRNVLQGCSWLFQPHGATRSPTFLLYQSGSRPKLAPGLDEKRFTSTKSSNTYTLTVSGFREQDEGYYFCLVVANTILHFSPFLPVFLPAAPTTTPAPPPPTQVPSALSPSVRPETCVLSKGGKAHTRWLDLTCDVYIWAPLAGTCAVLLLSLVLAVIFLRRNRRRVCKCPRPQVRPGGKPSPSGKFV