Sequence details NCBI ID: XP_004844582.1 (Protein)

Details from NCBI annotation

Gene Symbol Chchd5
Protein Name PREDICTED: coiled-coil-helix-coiled-coil-helix domain-containing protein 5 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004844525.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004844525.1 (Coding sequence)

Sequence Protein

Length: 119 aa     
View alignmentsRaw sequence   
>XP_004844582.1
MLRPCPSSIRQAALEITARYCGRELDQYGQCVAAKPESWQRDCHYLKMSIAQCTSAHPIIRQIRQACAEPFEAFEECLRQNEAAVGNCTEHVRRFLQCAEQVQLPHSPTPIEAQPLPTS