Sequence details NCBI ID: XP_004844312.1 (Protein)

Details from NCBI annotation

Gene Symbol Rgcc
Protein Name PREDICTED: regulator of cell cycle RGCC isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004844255.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004844255.1 (Coding sequence)

Sequence Protein

Length: 137 aa     
View alignmentsRaw sequence   
>XP_004844312.1
MKPPSAQGSPAATAAAAPALASVAAADLTDALCEFDAVLADFASPFHQRHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSAPALLSPSITPRKAKLGDTKELEDFIADLDRTLASM