Sequence details NCBI ID: XP_004843998.1 (Protein)

Details from NCBI annotation

Gene Symbol Cdk2ap1
Protein Name PREDICTED: cyclin-dependent kinase 2-associated protein 1 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004843941.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004843941.1 (Coding sequence)

Sequence Protein

Length: 114 aa     
Raw sequence   
>XP_004843998.1
MSYKPNLAHVPAAALSAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS