Sequence details NCBI ID: XP_004843692.1 (Protein)

Details from NCBI annotation

Gene Symbol Alkbh2
Protein Name PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004843635.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004843635.1 (Coding sequence)

Sequence Protein

Length: 261 aa     
View alignmentsRaw sequence   
>XP_004843692.1
MKRFLMKRAQGDHVGKGEQQEQTEEEPATLDKDPGGPRKRPRRETKERASHEAGSSWRHIRAEGLDCDYTVLFGKAEADEIFQELERKVEYFTGALARVLVFGKWHNVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERVRDCISGVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFIFRHKESRGKNPCQRVEVVRLQLAHGSLLMMNPPTNTHWYHSLPVRKKVLAPRVNLTFRKILPTKK