Sequence details NCBI ID: XP_004843604.1 (Protein)

Details from NCBI annotation

Gene Symbol Snrpd3
Protein Name PREDICTED: small nuclear ribonucleoprotein Sm D3 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004843547.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004843547.1 (Coding sequence)

Sequence Protein

Length: 126 aa     
Raw sequence   
>XP_004843604.1
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR