Sequence details NCBI ID: XP_004843187.1 (Protein)

Details from NCBI annotation

Gene Symbol Gins3
Protein Name PREDICTED: DNA replication complex GINS protein PSF3 [Heterocephalus glaber]

Database interlinks

Part of XM_004843130.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004843130.1 (Coding sequence)

Sequence Protein

Length: 216 aa     
View alignmentsRaw sequence   
>XP_004843187.1
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETPMPRLSTFFPEWGAGAGPDHALPQGSKLEFPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADANVVNLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNTYNEDISALVARLDEMERGLFQTGQKGLNNFQCWEKGQASQITPSNLVQNYKKRKFTDMED