Sequence detailsNCBI ID: XP_004843163.1 (Protein)

Details from NCBI annotation

Gene Symbol Tk2
Protein Name PREDICTED: thymidine kinase 2, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004843106.1 (SequenceType object (2))

There are 4 potential gene matches.

For more information consult the page for XM_004843106.1 (SequenceType object (2))

Sequence SequenceType object (4)

Length: 186 aa     
View alignmentsRaw sequence   
>XP_004843163.1
MEPVPKWRNVRGHNPLGLMYHDACRWGLTLQTYVQLTMLDQHTRPQMSPIRLMERSIHSARYIFVENLYRSGKMPEVDYVILSEWFDWIVKNINVSVDLIVYLRTTPETCHQRLKMRCREEEKVIPLEYLEAIHRLYEQWLVTGSLFPVTAPVLVIEADHNMEKMLQVFEQNRTRILTPENWKHGP