Sequence details NCBI ID: XP_004843159.1 (Protein)

Details from NCBI annotation

Gene Symbol Cmtm4
Protein Name PREDICTED: CKLF-like MARVEL transmembrane domain-containing protein 4 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004843102.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004843102.1 (Coding sequence)

Sequence Protein

Length: 208 aa     
View alignmentsRaw sequence   
>XP_004843159.1
MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMECSPCEGLYFFEFVSCSAFVVTGVLLILFSLNLHMRIPQINWNLTDLVNTGLSTFFFFIASIVLAALNHKTGAEIAAMIFGFLATAAYAVSTFLAVQKWRVSIRQQSANDYIRARTESRDVDSRPEIQRLDT