Sequence details NCBI ID: XP_004843130.1 (Protein)

Details from NCBI annotation

Gene Symbol Cbfb
Protein Name PREDICTED: core-binding factor subunit beta isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004843073.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004843073.1 (Coding sequence)

Sequence Protein

Length: 148 aa     
View alignmentsRaw sequence   
>XP_004843130.1
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQMRFQNACRDGRSEIVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLGGSDDLKLR