Sequence details NCBI ID: XP_004843094.1 (Protein)

Details from NCBI annotation

Gene Symbol Tppp3
Protein Name PREDICTED: tubulin polymerization-promoting protein family member 3 [Heterocephalus glaber]

Database interlinks

Part of XM_004843037.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004843037.1 (Coding sequence)

Sequence Protein

Length: 176 aa     
View alignmentsRaw sequence   
>XP_004843094.1
MAESTDVAGLQESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKGKSARVINYEEFKKALEELAPKRFKGKSKEEAFDAICQLVAGKEPANLGVTKAKTGGAVERLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK