Sequence details NCBI ID: XP_004843004.1 (Protein)

Details from NCBI annotation

Gene Symbol Nip7
Protein Name PREDICTED: 60S ribosome subunit biogenesis protein NIP7 homolog isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004842947.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842947.1 (Coding sequence)

Sequence Protein

Length: 180 aa     
View alignmentsRaw sequence   
>XP_004843004.1
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKMLKLAANISRDKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITESTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADVGEYIRHEETLT