Sequence details NCBI ID: XP_004842870.1 (Protein)

Details from NCBI annotation

Gene Symbol Clec3a
Protein Name PREDICTED: C-type lectin domain family 3 member A [Heterocephalus glaber]

Database interlinks

Part of XM_004842813.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842813.1 (Coding sequence)

Sequence Protein

Length: 196 aa     
View alignmentsRaw sequence   
>XP_004842870.1
MAKNGLVICILVICLLLDQTTGHPSKLKARNHSKRRVKEKDGDLKSQVEKLWREVNALKEMQALQTVCLRGTKFHRKCYLASEDIKHFHEANEDCISKGGILVVPRNSDEINALRDYGKKSLPGVNDFWLGINDMATEGKFLDVNGMAISFLNWDRAQPSGGKKENCVLFSQSAQGKWSDEVCRSSKRYICEFTIP