Sequence details NCBI ID: XP_004842863.1 (Protein)

Details from NCBI annotation

Gene Symbol Cmc2
Protein Name PREDICTED: tigger transposable element-derived protein 1 isoform X4 [Heterocephalus glaber]

Database interlinks

Part of XM_004842806.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842806.1 (Coding sequence)

Sequence Protein

Length: 79 aa     
View alignmentsRaw sequence   
>XP_004842863.1
MHPDLSLHLHTEECNILINLLKECHKNHSFLKFFGHCNHLDREMRKCLKNEYMEKRTRSRERGNDLRKRLFNPSEESEK