Sequence details NCBI ID: XP_004842739.1 (Protein)

Details from NCBI annotation

Gene Symbol Rnf166
Protein Name PREDICTED: RING finger protein 166 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004842682.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842682.1 (Coding sequence)

Sequence Protein

Length: 237 aa     
View alignmentsRaw sequence   
>XP_004842739.1
MAMFRSLVASAHQRQPPPGPAGGDSGLEAQYSCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHVSSCLKVQEQMANCPKFVPVVPTSQPIPSNVPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN