Sequence details NCBI ID: XP_004842720.1 (Protein)

Details from NCBI annotation

Gene Symbol Trappc2l
Protein Name PREDICTED: trafficking protein particle complex subunit 2-like protein isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004842663.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842663.1 (Coding sequence)

Sequence Protein

Length: 139 aa     
View alignmentsRaw sequence   
>XP_004842720.1
MAVCIAVIAKENYPLYIRSTPMENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSRVFDNMVTSMMIQVC