Sequence details NCBI ID: XP_004842283.1 (Protein)

Details from NCBI annotation

Gene Symbol Atp5j
Protein Name PREDICTED: ATP synthase-coupling factor 6, mitochondrial isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004842226.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004842226.1 (Coding sequence)

Sequence Protein

Length: 113 aa     
Raw sequence   
>XP_004842283.1
MILQRLFRFSAVVRSAVSVHFRRNIGVTAVAFNKHLDPIQKLFVDKIREYKSKRQTSGGPVDTGPEYQQDMERELFKLKQMYGKADMNTFPSFKFEGTFLIRFILTGNYFKWW