Sequence details NCBI ID: XP_004842106.1 (Protein)

Details from NCBI annotation

Gene Symbol Tceb1
Protein Name PREDICTED: transcription elongation factor B polypeptide 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004842049.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842049.1 (Coding sequence)

Sequence Protein

Length: 112 aa     
View alignmentsRaw sequence   
>XP_004842106.1
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC