Sequence details NCBI ID: XP_004842057.1 (Protein)

Details from NCBI annotation

Gene Symbol Zfand1
Protein Name PREDICTED: AN1-type zinc finger protein 1 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004842000.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004842000.1 (Coding sequence)

Sequence Protein

Length: 164 aa     
View alignmentsRaw sequence   
>XP_004842057.1
MAELDVGQHCQVEHCRQRDFLPFVCDGCSGIFCLEHRSRESHGCPEVTVISEKTKIDTNEPYPCSFKDCAQRELMAVICPYCEKNFCLSHRHQSDHECEKLEIPKPRMTATQALVKDIINSKTGETGNKRRKGAKNSETAAKVALMKLKLHADGDKSLPQGCLL