Sequence details NCBI ID: XP_004841529.1 (Protein)

Details from NCBI annotation

Gene Symbol Gng12
Protein Name PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004841472.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004841472.1 (Coding sequence)

Sequence Protein

Length: 72 aa     
View alignmentsRaw sequence   
>XP_004841529.1
MSSKTTSTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCTIL