Sequence details NCBI ID: XP_004840967.1 (Protein)

Details from NCBI annotation

Gene Symbol Nxt1
Protein Name PREDICTED: NTF2-related export protein 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004840910.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004840910.1 (Coding sequence)

Sequence Protein

Length: 140 aa     
View alignmentsRaw sequence   
>XP_004840967.1
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPNNTVWKIASDCFRFQDWAS