Sequence details NCBI ID: XP_004840648.1 (Protein)

Details from NCBI annotation

Gene Symbol Pdrg1
Protein Name PREDICTED: p53 and DNA damage-regulated protein 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004840591.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004840591.1 (Coding sequence)

Sequence Protein

Length: 133 aa     
View alignmentsRaw sequence   
>XP_004840648.1
MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGSMFIKMPHSQTKEMIEKDQEHLDKEIEKLRKQLKVKVNCLFEAQGKPELKGFNLNPLNQDELKALKIILKG