Sequence details NCBI ID: XP_004840333.1 (Protein)

Details from NCBI annotation

Gene Symbol Stard3nl
Protein Name PREDICTED: MLN64 N-terminal domain homolog isoform X8 [Heterocephalus glaber]

Database interlinks

Part of XM_004840276.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004840276.1 (Coding sequence)

Sequence Protein

Length: 235 aa     
View alignmentsRaw sequence   
>XP_004840333.1
MNPLPEDMESALTGSQSSRASLRDVHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVVQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAVALTTAVTSAFLLVKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLRIVQDASERAALIPAGLSDGQFYSPPESEAGSEEEAEEKQDSEKALLDL