Sequence details NCBI ID: XP_004840203.1 (Protein)

Details from NCBI annotation

Gene Symbol Znhit1
Protein Name PREDICTED: zinc finger HIT domain-containing protein 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004840146.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004840146.1 (Coding sequence)

Sequence Protein

Length: 154 aa     
View alignmentsRaw sequence   
>XP_004840203.1
MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLNVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV