Sequence details NCBI ID: XP_004840013.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrps17
Protein Name PREDICTED: 28S ribosomal protein S17, mitochondrial-like isoform X10 [Heterocephalus glaber]

Database interlinks

Part of XM_004839956.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004839956.1 (Coding sequence)

Sequence Protein

Length: 130 aa     
Raw sequence   
>XP_004840013.1
MSVPRSSVHAKWIVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIVFKVGRVIDPITGKPCAGTTYLESPISSETTQLTKTLEELNISSTQ