Sequence details NCBI ID: XP_004839996.1 (Protein)

Details from NCBI annotation

Gene Symbol Ube2d4
Protein Name PREDICTED: ubiquitin-conjugating enzyme E2 D4 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004839939.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004839939.1 (Coding sequence)

Sequence Protein

Length: 147 aa     
View alignmentsRaw sequence   
>XP_004839996.1
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPEVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAQEWTQKYAM