Sequence details NCBI ID: XP_004839613.1 (Protein)

Details from NCBI annotation

Gene Symbol Malsu1
Protein Name PREDICTED: mitochondrial assembly of ribosomal large subunit protein 1 [Heterocephalus glaber]

Database interlinks

Part of XM_004839556.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004839556.1 (Coding sequence)

Sequence Protein

Length: 232 aa     
View alignmentsRaw sequence   
>XP_004839613.1
MGTSSRVALRLGSLLWRGAASRGGDSAVAAMPRLQLLALGRLPAGPAPFRAYLTPDLVCGLHSRPQRDERTGGEARPEPGAADHTGPKFDIDMLVSLLRQENARDICVIKVPPEMRYADYFVIGSGTSTRHLHAMAYYIVKMYKYLKCKSEPHVKIEGKDTDDWLCVDFGSMVIHLMLPETRETYELEKLWTLRSYDDQLSQIPPEMLPEDFILGIEEEDTSLLTPGEFKCE