Sequence details NCBI ID: XP_004839505.1 (Protein)

Details from NCBI annotation

Gene Symbol Cib4
Protein Name PREDICTED: calcium and integrin-binding family member 4 [Heterocephalus glaber]

Database interlinks

Part of XM_004839448.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004839448.1 (Coding sequence)

Sequence Protein

Length: 255 aa     
View alignmentsRaw sequence   
>XP_004839505.1
MGQCSRYQMCWEDLEEYQALTFLTRSEILCIHNTFLKLCPEGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHNNVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIVLRLLNSDDVSEDLLMDLTQQVLSESDLDNDNMLSFSEFEHAMAKSPDFMNCFRIHFWGCWSDCRLPQHLEGHHWEPSPDPGEKSQSLTVSPSPGMDLTTPGQFGAQLVRGSGTQVTPLAGGPESGQVPT