Sequence details NCBI ID: XP_004839459.1 (Protein)

Details from NCBI annotation

Gene Symbol Mcfd2
Protein Name PREDICTED: multiple coagulation factor deficiency protein 2 [Heterocephalus glaber]

Database interlinks

Part of XM_004839402.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004839402.1 (Coding sequence)

Sequence Protein

Length: 146 aa     
View alignmentsRaw sequence   
>XP_004839459.1
MRSLWLLRTPLLYSLLWAFCASSARAHDPGANAVHPGSVGLDKHTVHNPEHIMEHLEGVINKPEATMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEDGGEQAPLMSEDELISIIDGVLRDDDKNNDGYIDYAEFAKSLQ