Sequence details NCBI ID: XP_004839243.1 (Protein)

Details from NCBI annotation

Gene Symbol Dnajc5g
Protein Name PREDICTED: dnaJ homolog subfamily C member 5G [Heterocephalus glaber]

Database interlinks

Part of XM_004839186.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004839186.1 (Coding sequence)

Sequence Protein

Length: 172 aa     
View alignmentsRaw sequence   
>XP_004839243.1
MSHVDEAARQLSKSGTTLYAVLELKKGSSPEDIKKSYRKLALQYHPDKNPGNPQAAEIFKEINTAHAILSDPKKRKIYDQHGSFGIYLYDHFGEDGVRYYFIVNSCWFKTLVLLCALLTCCCCCCCCCFCCGTLNLPPEEINRKNHQQNVRTQPSRSGTKHHFGTDEDSDDN