Sequence details NCBI ID: XP_004838660.1 (Protein)

Details from NCBI annotation

Gene Symbol Morn4
Protein Name PREDICTED: MORN repeat-containing protein 4 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004838603.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004838603.1 (Coding sequence)

Sequence Protein

Length: 146 aa     
View alignmentsRaw sequence   
>XP_004838660.1
MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLLFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRQDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQQAQSASKSARNLTA