Sequence details NCBI ID: XP_004838309.1 (Protein)

Details from NCBI annotation

Gene Symbol Mlana
Protein Name PREDICTED: melanoma antigen recognized by T-cells 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004838252.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004838252.1 (Coding sequence)

Sequence Protein

Length: 118 aa     
View alignmentsRaw sequence   
>XP_004838309.1
MPQEEGHFSHGYPRKGHGHAYITTEEAAGIGILTVILGILLLIGCWYCRRQSGYRTLMDKNLHAGVQGTLCGRCSHEELGHQDTKLFFQEKNCEPLVPNAPPAYEKLSREQSPPPYSP