Sequence details NCBI ID: XP_004838294.1 (Protein)

Details from NCBI annotation

Gene Symbol Ak3
Protein Name PREDICTED: GTP:AMP phosphotransferase AK3, mitochondrial isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004838237.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004838237.1 (Coding sequence)

Sequence Protein

Length: 227 aa     
View alignmentsRaw sequence   
>XP_004838294.1
MGASARLLRAVIMGAPGSGKGTVSSRILQHFALKHLSSGDLLRRNMLQGTEIGVLAKTFIDQGKLIPDDVMTRLALHELKNLTQESWLLDGFPRTLPQAEALDKAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVLKRLKAYEAQTEPVLEYYQKKGVLETFSGTETNKIWPHVYAFLQTKVPQTNQKASVTP