Sequence details NCBI ID: XP_004837925.1 (Protein)

Details from NCBI annotation

Gene Symbol Lypd2
Protein Name PREDICTED: ly6/PLAUR domain-containing protein 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004837868.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004837868.1 (Coding sequence)

Sequence Protein

Length: 127 aa     
View alignmentsRaw sequence   
>XP_004837925.1
MNGADLLDHRTWPSAWKAEDEEPTRQRMWPVLLVLALAAHRELGTHDCIQLHHHHRVQCQRNHVQDHALLLGDGCEPSDVDGIGQTRPVSCCNTDLCNVDRAPALGGAHSLALAFALPLAHLMGLGL