Sequence details NCBI ID: XP_004837759.1 (Protein)

Details from NCBI annotation

Gene Symbol Cyhr1
Protein Name PREDICTED: cysteine and histidine-rich protein 1-A isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004837702.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004837702.1 (Coding sequence)

Sequence Protein

Length: 311 aa     
View alignmentsRaw sequence   
>XP_004837759.1
MVPKPGGEWSTVLSHLALGVVSLHAAVSSVQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNINLRLFLFQIQK