Sequence details NCBI ID: XP_004837593.1 (Protein)

Details from NCBI annotation

Gene Symbol Ube2v2
Protein Name PREDICTED: ubiquitin-conjugating enzyme E2 variant 2 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004837536.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004837536.1 (Coding sequence)

Sequence Protein

Length: 145 aa     
Raw sequence   
>XP_004837593.1
MAESSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVILQELRRLMMSKENMKLPQPPEGQTYNN