Sequence details NCBI ID: XP_004837257.1 (Protein)

Details from NCBI annotation

Gene Symbol Isca2
Protein Name PREDICTED: iron-sulfur cluster assembly 2 homolog, mitochondrial [Heterocephalus glaber]

Database interlinks

Part of XM_004837200.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004837200.1 (Coding sequence)

Sequence Protein

Length: 154 aa     
View alignmentsRaw sequence   
>XP_004837257.1
MAATRGQYVTAALLRAVIPRQRSRILEASAELQARREASSSGPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSRELIRSSFQVLNNPQAQQGCSCGSSFSIKL