Sequence details NCBI ID: XP_004837223.1 (Protein)

Details from NCBI annotation

Gene Symbol Batf
Protein Name PREDICTED: basic leucine zipper transcriptional factor ATF-like [Heterocephalus glaber]

Database interlinks

Part of XM_004837166.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004837166.1 (Coding sequence)

Sequence Protein

Length: 125 aa     
View alignmentsRaw sequence   
>XP_004837223.1
MPHNSDSSDSSFSRSSPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLATSTPSPPEVVYSAHAFHQPHVGSPRFQP