Sequence details NCBI ID: XP_004837133.1 (Protein)

Details from NCBI annotation

Gene Symbol Efcab11
Protein Name PREDICTED: EF-hand calcium-binding domain-containing protein 11 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004837076.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004837076.1 (Coding sequence)

Sequence Protein

Length: 163 aa     
View alignmentsRaw sequence   
>XP_004837133.1
MSLSEAGARPRTWDASPSEHRKWVEVFKACDEDNKGYLSREDFKVAVVMLFGYKPSKIEADSVMSSINPNTSGIVLGEFLNIIRKKKEAQLYRNEIRHIFTAFDVHYRGYLTLEDFKKAFSQVAPRLPERTVLEVFREVDRDSDGHVSFRDFEYAMKHGQNEA