Sequence details NCBI ID: XP_004837099.1 (Protein)

Details from NCBI annotation

Gene Symbol Prima1
Protein Name PREDICTED: proline-rich membrane anchor 1 isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004837042.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004837042.1 (Coding sequence)

Sequence Protein

Length: 153 aa     
View alignmentsRaw sequence   
>XP_004837099.1
MLLRDLVLRRGCRWPSLLLHCALHPLWGFVQVTHGEPQKSCSTVTDSCQHLCQCRPPPPLPPPPPPPPPPRLLSAPAPNSTSCPAEESWWSGLVIVIAVCCASLVFLTVLVIICYKAIKRKPLRKDENGTSVAEYPMSSSQSTKGVDVSNAMV