Sequence details NCBI ID: XP_004836748.1 (Protein)

Details from NCBI annotation

Gene Symbol Nhp2
Protein Name PREDICTED: H/ACA ribonucleoprotein complex subunit 2 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004836691.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004836691.1 (Coding sequence)

Sequence Protein

Length: 153 aa     
Raw sequence   
>XP_004836748.1
MTKIKADPDGPEAQAEACGGERTYQELLVNLNPIAQPLAPRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRSLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQALPSPL