Sequence details NCBI ID: XP_004836708.1 (Protein)

Details from NCBI annotation

Gene Symbol Lyrm7
Protein Name PREDICTED: complex III assembly factor LYRM7 isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004836651.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004836651.1 (Coding sequence)

Sequence Protein

Length: 104 aa     
Raw sequence   
>XP_004836708.1
MGQAAKQVLQLFKTLHRTRQQVFQNDPRALEARIKINEEFKSNKSETSPRKIEELMKIGSDVEVLFRTSVIQGIHTGHNTLKLVPRKDLLIENVPYCDVPTQKQ