Sequence details NCBI ID: XP_004836560.1 (Protein)

Details from NCBI annotation

Gene Symbol Mrpl22
Protein Name PREDICTED: 39S ribosomal protein L22, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004836503.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004836503.1 (Coding sequence)

Sequence Protein

Length: 212 aa     
View alignmentsRaw sequence   
>XP_004836560.1
MAAAVLRELGTLWIQNLRSRGTLALGLLSSHSVLPQSHIHMSAPLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEILLEAQDMAVKDHNVEFRSNLYVAESTSGRGQYLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPKPPKTAMDHAKEYIQQLRSRTIIHTL