Sequence details NCBI ID: XP_004836228.1 (Protein)

Details from NCBI annotation

Gene Symbol Ap3s1
Protein Name PREDICTED: AP-3 complex subunit sigma-1 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004836171.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004836171.1 (Coding sequence)

Sequence Protein

Length: 193 aa     
View alignmentsRaw sequence   
>XP_004836228.1
MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK