Sequence details NCBI ID: XP_004835379.1 (Protein)

Details from NCBI annotation

Gene Symbol Emc3
Protein Name PREDICTED: ER membrane protein complex subunit 3 isoform X1 [Heterocephalus glaber]

Database interlinks

Part of XM_004835322.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004835322.1 (Coding sequence)

Sequence Protein

Length: 261 aa     
View alignmentsRaw sequence   
>XP_004835379.1
MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAVAMPADTNKAFKTEWEALELTDHQWALDDVEEELMTKDLHFEGMFKKELQTSIF