Sequence details NCBI ID: XP_004835144.1 (Protein)

Details from NCBI annotation

Gene Symbol Higd1a
Protein Name PREDICTED: HIG1 domain family member 1A, mitochondrial isoform X2 [Heterocephalus glaber]

Database interlinks

Part of XM_004835087.1 (Coding sequence)

There are 2 potential gene matches.

For more information consult the page for XM_004835087.1 (Coding sequence)

Sequence Protein

Length: 93 aa     
Raw sequence   
>XP_004835144.1
MSSNTDVSLSSYDEDQGSKLIRKAKEAPFVPLGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYSMYQEFWAKPKP