Sequence details NCBI ID: XP_004834722.1 (Protein)

Details from NCBI annotation

Gene Symbol Rpl35a
Protein Name PREDICTED: 60S ribosomal protein L35a isoform X3 [Heterocephalus glaber]

Database interlinks

Part of XM_004834665.1 (Coding sequence)

There are 3 potential gene matches.

For more information consult the page for XM_004834665.1 (Coding sequence)

Sequence Protein

Length: 110 aa     
View alignmentsRaw sequence   
>XP_004834722.1
MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI