Sequence details NCBI ID: XP_004834085.1 (Protein)

Details from NCBI annotation

Gene Symbol Tcta
Protein Name PREDICTED: T-cell leukemia translocation-altered gene protein homolog [Heterocephalus glaber]

Database interlinks

Part of XM_004834028.1 (Coding sequence)

There are 4 potential gene matches.

For more information consult the page for XM_004834028.1 (Coding sequence)

Sequence Protein

Length: 112 aa     
View alignmentsRaw sequence   
>XP_004834085.1
MRRGPIMAEPWFGQYLQALPATVVAALGALGSEFLREWEAQDMRVTLFKLLLLWLVLSFLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANELLKTHRE